PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00036294001
Common NameGSBRNA2T00036294001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 218aa    MW: 23948.4 Da    PI: 5.8021
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00036294001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.68.9e-43561551100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++l
  GSBRNA2T00036294001  56 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARMRDPVYGCAGAIYHLQRQVSEL 145
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+l++++ e
  GSBRNA2T00036294001 146 QAQLVKTQVE 155
                          ****998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE patternPS001380919IPR023828Peptidase S8, subtilisin, Ser-active site
PROSITE profilePS5089126.31355156IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-4256153IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MLKMEINGGT SAATPTVSAV AVATVKETTT PINSPSPTSS PPPPPLSPQQ TVVLSPCAAC  60
KILRRRCAEK CVLAPYFPPT DPAKFTIAHR VFGASNIIKF LQELPESQRT DAVNSMVYEA  120
GARMRDPVYG CAGAIYHLQR QVSELQAQLV KTQVELVSMQ LQRSDLLELL YKMEQTKLAA  180
QEQGQQNMSF EMTNDLGFLE DNNNNNSSMS WWDPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892991e-169AC189299.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB028K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140905.11e-137PREDICTED: LOB domain-containing protein 11
SwissprotQ9SK081e-117LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A078JDD11e-162A0A078JDD1_BRANA; BnaA04g28360D protein
STRINGBra035698.1-P1e-134(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-106LOB domain-containing protein 11
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]